Recombinant Human ANGPTL3 protein, GST-tagged
Cat.No. : | ANGPTL3-556H |
Product Overview : | Human ANGPTL3 full-length ORF ( AAH58287, 17 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fibrinogen chain. The N-terminal chain is important for lipid metabolism, while the C-terminal chain may be involved in angiogenesis. Mutations in this gene cause familial hypobetalipoproteinemia type 2. [provided by RefSeq, Aug 2015] |
Molecular Mass : | 74.58 kDa |
AA Sequence : | SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANGPTL3 angiopoietin-like 3 [ Homo sapiens ] |
Official Symbol | ANGPTL3 |
Synonyms | ANGPTL3; angiopoietin-like 3; ANGPT5; angiopoietin-related protein 3; angiopoietin 5; ANG-5; FHBL2; |
Gene ID | 27329 |
mRNA Refseq | NM_014495 |
Protein Refseq | NP_055310 |
MIM | 604774 |
UniProt ID | Q9Y5C1 |
◆ Recombinant Proteins | ||
Angptl3-1819M | Recombinant Mouse Angptl3 protein, His & GST-tagged | +Inquiry |
ANGPTL3-9649H | Recombinant Human ANGPTL3, GST-tagged | +Inquiry |
ANGPTL3-101H | Recombinant Human ANGPTL3, His-tagged | +Inquiry |
ANGPTL3-32H | Recombinant Human ANGPTL3 protein, His-tagged | +Inquiry |
ANGPTL3-117H | Recombinant Human ANGPTL3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL3-8862HCL | Recombinant Human ANGPTL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANGPTL3 Products
Required fields are marked with *
My Review for All ANGPTL3 Products
Required fields are marked with *
0
Inquiry Basket