Recombinant Human ANGPTL4 Protein, His-tagged

• Cat.No.: ANGPTL4-091H
• Product Overview: Recombinant human ANGPTL4 protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 406
• Description: This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4.
• Form: Lyophilized
• Molecular Mass: 27.9 kDa
• AA Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: ANGPTL4 angiopoietin-like 4 [ Homo sapiens (human) ]
• Official Symbol: ANGPTL4
• Synonyms: ANGPTL4; angiopoietin-like 4; angiopoietin-related protein 4; angiopoietin related protein 4; ARP4; fasting induced adipose factor; FIAF; hepatic angiopoietin related protein; hepatic fibrinogen/angiopoietin related protein; HFARP; NL2; peroxisome proliferator activated receptor (PPAR) gamma induced angiopoietin related protein; PGAR; pp1158; PPARG angiopoietin related protein; angiopoietin-like protein 4; fasting-induced adipose factor; hepatic angiopoietin-related protein; hepatic fibrinogen/angiopoietin-related protein; peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein; ANGPTL2
• Gene ID: 51129
• mRNA Refseq: NM_001039667
• Protein Refseq: NP_001034756
• MIM: 605910
• UniProt ID: Q9BY76