Recombinant Human ANGPTL4 Protein, FLAG-tagged
Cat.No. : | ANGPTL4-102H |
Product Overview : | Human ANGPTL4 (Total 392 AA) recombinant protein with C-Terminal Flag-tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Protein Length : | 26-406 aa |
Molecular Mass : | 44.2 kDa (calculated) |
AA Sequence : | GPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAASAAADYKDDDDK |
Endotoxin : | < 1.0 EU/ug |
Purity : | Purity as determined by densitometric image analysis: >90% |
Applications : | WB, ELISA, Cell culture and/or animal studies |
Quality Control Test : | BCA to determine quantity of the protein. SDS PAGE to determine purity of the protein. LAL to determine quantity of endotoxin. |
Notes : | This product is intended for research use only. |
Storage : | Store the lyophilized protein at –80 centigrade. Lyophilized protein remains stable until the expiry date when stored at –80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week. |
Storage Buffer : | Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4 |
Reconstitution : | Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture. |
Gene Name | ANGPTL4 angiopoietin like 4 [ Homo sapiens (human) ] |
Official Symbol | ANGPTL4 |
Synonyms | ANGPTL4; angiopoietin like 4; FIAF; NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158; angiopoietin-related protein 4; PPARG angiopoietin related protein; fasting-induced adipose factor; hepatic angiopoietin-related protein; hepatic fibrinogen/angiopoietin-related protein; peroxisome proliferator-activated receptor (PPAR) gamma induced angiopoietin-related protein |
Gene ID | 51129 |
mRNA Refseq | NM_001039667 |
Protein Refseq | NP_001034756 |
MIM | 605910 |
UniProt ID | Q9BY76 |
◆ Recombinant Proteins | ||
ANGPTL4-102H | Recombinant Human ANGPTL4 Protein, FLAG-tagged | +Inquiry |
ANGPTL4-268H | Active Recombinant Human ANGPTL4 protein, His-tagged | +Inquiry |
Angptl4-7743M | Recombinant Mouse Angptl4 protein, His-tagged | +Inquiry |
ANGPTL4-496H | Recombinant Human ANGPTL4 Protein, DDK/His-tagged | +Inquiry |
Angptl4-104R | Active Recombinant Rat Angptl4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPTL4-746MCL | Recombinant Mouse ANGPTL4 cell lysate | +Inquiry |
ANGPTL4-1097HCL | Recombinant Human ANGPTL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL4 Products
Required fields are marked with *
My Review for All ANGPTL4 Products
Required fields are marked with *