| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. Lyophilized from a sterile (0.2 μm) filtered aqueous solution containing 20mM PBS, pH 7.8 and 5% trehalose. |
| Bio-activity : |
When Recombinant Human ApoE4 is immobilized at 1 μg/mL (100 μL/well), the concentration of recombinant mouse VLDLR that produces 50% of the optimal binding response is found to be approximately 0.075-0.375 μg/mL. |
| Molecular Mass : |
34.4 kDa |
| AASequence : |
KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH |
| Purity : |
> 95% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE. |
| Storage : |
Lyophilized APOE4 although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution APOE4 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Shipping : |
Shipped at Room temperature. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized APOE4 in sterile 18M-cm H2O not less than 100 μg/mL, which can then be further diluted to other aqueous solutions. |
