Active Recombinant Full Length Human APOE4 Protein

• Cat.No.: APOE4-01HFL
• Product Overview: Active Recombinant Full Length Human APOE4 Protein was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Protein Length: 1-317 aa
• Description: Apolipoprotein E (ApoE) is a 299 amino acid protein, produced by the liver and circulating macrophages, that is a constituent of every plasma lipoprotein except the smallest low density lipoproteins (LDL). It is a key player in the recycling and redistribution of lipids and cholesterol. ApoE is a ligand with a high affinity for low density lipoprotein receptors (LDLR). It regulates the activity of enzymes that metabolize lipids and also make lipids soluble. Mice and humans that lack ApoE cannot remove excess lipoproteins from the plasma and have an increased risk of atherosclerosis. Defective binding of ApoE to its receptors will lead to accumulation of cholesterol-rich lipoprotein particles in the plasma; this is the cause of type III hyperlipoproteinemia. There are three main isoforms of ApoE all products of alleles at a single gene locus: E2 (Cys112, Cys158), E3 (Cys112, Arg158), and E4 (Arg112, Arg158).
• Form: Lyophilized
• AASequence: MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
• Molecular Mass: 35 kDa
• Bio-activity: ELISA binding
• Optimal pH: 0
• Isoelectric Point: 0
• Endotoxin: < 1 EU/μg
• Purity: ≥ 90% by SDS-PAGE
• Application: ELISA, FA, WB
• Storage: This lyophilized protein is stable for twelve months when stored at -20 centigrade to -70 centigrade. After aseptic reconstitution, this protein may be stored for one month at 2 centigrade to 8 centigrade or for three months at -20 centigrade to -70 centigrade in a manual defrost freezer. Avoid Repeated Freeze Thaw Cycles.
• Storage Buffer: This lyophilized protein is 0.22 μm sterile filtered and lyophilized from 20 mM Sodium Phosphate, pH 7.8 + 0.5 mM DTT.
• Reconstitution: Reconstitute at 0.1-1 mg/mL using filtered deionized water. Gently mix by vortexing and/or inversion until fully dissolved. Centrifuge if necessary.
• Shipping: Ambient

Gene Information

• Gene Name: APOE apolipoprotein E [ Homo sapiens (human) ]
• Official Symbol: APOE
• Synonyms: APOE; apolipoprotein E; AD2; LPG; APO-E; ApoE4; LDLCQ5; apolipoprotein E; apolipoprotein E3
• Gene ID: 348
• mRNA Refseq: NM_000041
• Protein Refseq: NP_000032
• MIM: 107741
• UniProt ID: P02649