Recombinant Human ApoE4 Protein
Cat.No. : | APOE-02H |
Product Overview : | Recombinant Human ApoE4 Protein (1-299, Arg-61-Thr) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 1-299 |
Description : | The protein encoded by this gene is a major apoprotein of the chylomicron. It binds to a specific liver and peripheral cell receptor, and is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. This gene maps to chromosome 19 in a cluster with the related apolipoprotein C1 and C2 genes. Mutations in this gene result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. |
Form : | Lyophilized |
Molecular Mass : | 34 kDa |
AA Sequence : | MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELTALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH |
Purity : | 95% by Chromatography and SDS-PAGE |
Storage : | Store at -20 centigrade upon arrival. |
Dilutions : | ApoE is soluble in PBS. |
Gene Name | APOE apolipoprotein E [ Homo sapiens (human) ] |
Official Symbol | APOE |
Synonyms | APOE; apolipoprotein E; AD2; LPG; APO-E; ApoE4; LDLCQ5; apolipoprotein E; apolipoprotein E3 |
Gene ID | 348 |
mRNA Refseq | NM_000041 |
Protein Refseq | NP_000032 |
MIM | 107741 |
UniProt ID | P02649 |
◆ Recombinant Proteins | ||
APOE4-2867H | Active Recombinant Human APOE4 protein, His-tagged | +Inquiry |
APOE4-2868H | Recombinant Human APOE4 protein, His-Avi-tagged, Biotinylated | +Inquiry |
APOE4-2872H | Active Recombinant Human APOE4 protein, His-tagged | +Inquiry |
APOE-02H | Recombinant Human ApoE4 Protein | +Inquiry |
APOE4-2873H | Active Recombinant Human APOE4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ApoE4 Products
Required fields are marked with *
My Review for All ApoE4 Products
Required fields are marked with *
0
Inquiry Basket