Recombinant Human ASIC1 Protein, GST-Tagged

Cat.No. : ASIC1-151H
Product Overview : Human ACCN2 full-length ORF ( NP_001086.2, 1 a.a. - 528 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the acid-sensing ion channel (ASIC) family of proteins, which are part of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. Members of the ASIC family are sensitive to amiloride and function in neurotransmission. The encoded proteins function in learning, pain transduction, touch sensation, and development of memory and fear. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]
Molecular Mass : 61.2 kDa
AA Sequence : MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASIC1 acid sensing ion channel subunit 1 [ Homo sapiens (human) ]
Official Symbol ASIC1
Synonyms ASIC1; acid sensing ion channel subunit 1; Acid Sensing Ion Channel Subunit 1; Amiloride-Sensitive Cation Channel 2, Neuronal; Acid Sensing (Proton Gated) Ion Channel 1; Brain Sodium Channel 2; ACCN2; BNaC2; Cation Channel, Amiloride-Sensitive, Neuronal, 2; Acid-Sensing (Proton-Gated) Ion Channel 1; Acid-Sensing Ion Channel 1a Protein; Acid-Sensing Ion Channel 1; ASIC; acid-sensing ion channel 1; Cation channel, amiloride-sensitive, neuronal, 2; acid sensing (proton gated) ion channel 1; acid-sensing ion channel 1a protein; amiloride-sensitive cation channel 2, neuronal; brain sodium channel 2
Gene ID 41
mRNA Refseq NM_001095
Protein Refseq NP_001086
MIM 602866
UniProt ID P78348

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASIC1 Products

Required fields are marked with *

My Review for All ASIC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon