Recombinant Human ACCN2 Protein, GST-Tagged
Cat.No. : | ASIC1-152H |
Product Overview : | Human ACCN2 partial ORF ( NP_064423.2, 96 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the acid-sensing ion channel (ASIC) family of proteins, which are part of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. Members of the ASIC family are sensitive to amiloride and function in neurotransmission. The encoded proteins function in learning, pain transduction, touch sensation, and development of memory and fear. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012] |
Molecular Mass : | 61.2 kDa |
AA Sequence : | MGTEKESPEPDCQKQFQAAVSVIQNLPKNGSYRPSYEEMLRFYSYYKQATMGPCLVPRPGFWDPIGRYKWDAWNSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLRRVTGWKEQVVNGDVGAVSEPPCLPKEPAPPSPESHSPRDLDSEVFCDSLEQLEPELVWTEQRAASGGKRDPRNSPVPPTKKEGLRGSPPGPQELDVWLLGTVRALQESMQEVQARVQSLESMPRPPEQRPQPRPSARPWPLGLPGPALLFFLLWPFVVQWLFRMFRTQKR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASIC1 acid sensing ion channel subunit 1 [ Homo sapiens (human) ] |
Official Symbol | ASIC1 |
Synonyms | ASIC1; acid sensing ion channel subunit 1; Acid Sensing Ion Channel Subunit 1; Amiloride-Sensitive Cation Channel 2, Neuronal; Acid Sensing (Proton Gated) Ion Channel 1; Brain Sodium Channel 2; ACCN2; BNaC2; Cation Channel, Amiloride-Sensitive, Neuronal, 2; Acid-Sensing (Proton-Gated) Ion Channel 1; Acid-Sensing Ion Channel 1a Protein; Acid-Sensing Ion Channel 1; ASIC; acid-sensing ion channel 1; Cation channel, amiloride-sensitive, neuronal, 2; acid sensing (proton gated) ion channel 1; acid-sensing ion channel 1a protein; amiloride-sensitive cation channel 2, neuronal; brain sodium channel 2 |
Gene ID | 41 |
mRNA Refseq | NM_001095 |
Protein Refseq | NP_001086 |
MIM | 602866 |
UniProt ID | P78348 |
◆ Recombinant Proteins | ||
ASIC1-5523HFL | Recombinant Full Length Human ASIC1 protein, Flag-tagged | +Inquiry |
ASIC117343C | Recombinant Human ASIC1 (chicken) (26-463) Protein | +Inquiry |
ASIC1-4965H | Recombinant Human ASIC1 protein | +Inquiry |
ASIC1-4964H | Recombinant Human ASIC1 protein | +Inquiry |
ASIC1-32H | Recombinant Human ASIC1 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASIC1-9102HCL | Recombinant Human ACCN2 293 Cell Lysate | +Inquiry |
ASIC1-9101HCL | Recombinant Human ACCN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASIC1 Products
Required fields are marked with *
My Review for All ASIC1 Products
Required fields are marked with *