Recombinant Human ATP2B4
Cat.No. : | ATP2B4-27795TH |
Product Overview : | Recombinant fragment of Human Calcium Pump PMCA4 ATPase with a N terminal proprietary tag: predicted molecular weight 35.75 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 92 amino acids |
Description : | The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 35.750kDa inclusive of tags |
Tissue specificity : | Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT* |
Sequence Similarities : | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIB subfamily. |
Gene Name | ATP2B4 ATPase, Ca++ transporting, plasma membrane 4 [ Homo sapiens ] |
Official Symbol | ATP2B4 |
Synonyms | ATP2B4; ATPase, Ca++ transporting, plasma membrane 4; ATP2B2, matrix remodelling associated 1 , MXRA1; plasma membrane calcium-transporting ATPase 4; plasma membrane calcium transporting ATPase 4; PMCA4; |
Gene ID | 493 |
mRNA Refseq | NM_001001396 |
Protein Refseq | NP_001001396 |
MIM | 108732 |
Uniprot ID | P23634 |
Chromosome Location | 1q32.1 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hemostasis, organism-specific biosystem; Ion channel transport, organism-specific biosystem; |
Function | ATP binding; PDZ domain binding; calcium-transporting ATPase activity; calmodulin binding; hydrolase activity; |
◆ Recombinant Proteins | ||
Atp2b4-1767M | Recombinant Mouse Atp2b4 Protein, Myc/DDK-tagged | +Inquiry |
ATP2B4-520R | Recombinant Rat ATP2B4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP2B4-6544H | Recombinant Human ATP2B4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATP2B4-2945H | Recombinant Human ATP2B4 Protein, MYC/DDK-tagged | +Inquiry |
ATP2B4-280R | Recombinant Rhesus Macaque ATP2B4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP2B4 Products
Required fields are marked with *
My Review for All ATP2B4 Products
Required fields are marked with *
0
Inquiry Basket