Recombinant Human ATP2B4

Cat.No. : ATP2B4-27795TH
Product Overview : Recombinant fragment of Human Calcium Pump PMCA4 ATPase with a N terminal proprietary tag: predicted molecular weight 35.75 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 92 amino acids
Description : The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 35.750kDa inclusive of tags
Tissue specificity : Isoform XB is the most abundant isoform and is expressed ubiquitously. Isoforms containing segment Z have only been detected in heart, while isoforms containing segment a have been found in heart, stomach and brain cortex.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT*
Sequence Similarities : Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIB subfamily.
Gene Name ATP2B4 ATPase, Ca++ transporting, plasma membrane 4 [ Homo sapiens ]
Official Symbol ATP2B4
Synonyms ATP2B4; ATPase, Ca++ transporting, plasma membrane 4; ATP2B2, matrix remodelling associated 1 , MXRA1; plasma membrane calcium-transporting ATPase 4; plasma membrane calcium transporting ATPase 4; PMCA4;
Gene ID 493
mRNA Refseq NM_001001396
Protein Refseq NP_001001396
MIM 108732
Uniprot ID P23634
Chromosome Location 1q32.1
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hemostasis, organism-specific biosystem; Ion channel transport, organism-specific biosystem;
Function ATP binding; PDZ domain binding; calcium-transporting ATPase activity; calmodulin binding; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP2B4 Products

Required fields are marked with *

My Review for All ATP2B4 Products

Required fields are marked with *

0
cart-icon
0
compare icon