Recombinant Human BMI1
Cat.No. : | BMI1-27486TH |
Product Overview : | Recombinant full length protein of Human Bmi1 with proprietary tag; predicted MW 61.60 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 326 amino acids |
Description : | BMI1 polycomb ring finger oncogene, also known as BMI1, is a protein which in humans is encoded by the BMI1 gene. |
Molecular Weight : | 61.600kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCK TCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVY KLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVND KRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQ SPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGS SATSSG |
Sequence Similarities : | Contains 1 RING-type zinc finger. |
Gene Name | BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ] |
Official Symbol | BMI1 |
Synonyms | BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse) , PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51; |
Gene ID | 648 |
mRNA Refseq | NM_005180 |
Protein Refseq | NP_005171 |
MIM | 164831 |
Uniprot ID | P35226 |
Chromosome Location | 10p13 |
Pathway | Senescence and Autophagy, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function | RING-like zinc finger domain binding; chromatin binding; metal ion binding; protein binding; ubiquitin-protein ligase activity; |
◆ Recombinant Proteins | ||
BMI1-495H | Recombinant Human BMI1 Protein(1-250aa), GST-tagged | +Inquiry |
BMI1-135H | Recombinant Human BMI1 protein, Arginine-tagged | +Inquiry |
BMI1-1371H | Recombinant Human BMI1 Protein (Glu152-Ile289), His tagged | +Inquiry |
BMI1-771H | Recombinant Human BMI1 Protein, His tagged | +Inquiry |
BMI1-316H | Recombinant Human BMI1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMI1-8437HCL | Recombinant Human BMI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMI1 Products
Required fields are marked with *
My Review for All BMI1 Products
Required fields are marked with *