Recombinant Human C4BPB
Cat.No. : | C4BPB-26312TH |
Product Overview : | Recombinant full length Human C4 binding protein with N terminal proprietary tag; predicted MWt: 53.35 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 252 amino acids |
Description : | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. |
Molecular Weight : | 53.350kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEV EGQILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLG HCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRS QCLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGS TISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPK PECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYS LELKKAELKAKLL |
Sequence Similarities : | Contains 3 Sushi (CCP/SCR) domains. |
Gene Name | C4BPB complement component 4 binding protein, beta [ Homo sapiens ] |
Official Symbol | C4BPB |
Synonyms | C4BPB; complement component 4 binding protein, beta; C4BP, complement component 4 binding protein, beta; C4b-binding protein beta chain; C4b binding protein; beta chain; complement component 4 binding protein; |
Gene ID | 725 |
mRNA Refseq | NM_000716 |
Protein Refseq | NP_000707 |
MIM | 120831 |
Uniprot ID | P20851 |
Chromosome Location | 1q32 |
Pathway | Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem; |
◆ Recombinant Proteins | ||
C4BPB-26312TH | Recombinant Human C4BPB | +Inquiry |
C4BPB-43HF | Recombinant Full Length Human C4BPB Protein | +Inquiry |
C4BPB-1421H | Recombinant Human C4BPB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
C4BPB-474H | Recombinant Human C4BPB Protein, His (Fc)-Avi-tagged | +Inquiry |
C4BPB-2631HF | Recombinant Full Length Human C4BPB Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C4BPB-8036HCL | Recombinant Human C4BPB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All C4BPB Products
Required fields are marked with *
My Review for All C4BPB Products
Required fields are marked with *
0
Inquiry Basket