Recombinant Human C4BPB

Cat.No. : C4BPB-26312TH
Product Overview : Recombinant full length Human C4 binding protein with N terminal proprietary tag; predicted MWt: 53.35 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 252 amino acids
Description : This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants.
Molecular Weight : 53.350kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEV EGQILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLG HCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRS QCLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGS TISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPK PECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYS LELKKAELKAKLL
Sequence Similarities : Contains 3 Sushi (CCP/SCR) domains.
Gene Name C4BPB complement component 4 binding protein, beta [ Homo sapiens ]
Official Symbol C4BPB
Synonyms C4BPB; complement component 4 binding protein, beta; C4BP, complement component 4 binding protein, beta; C4b-binding protein beta chain; C4b binding protein; beta chain; complement component 4 binding protein;
Gene ID 725
mRNA Refseq NM_000716
Protein Refseq NP_000707
MIM 120831
Uniprot ID P20851
Chromosome Location 1q32
Pathway Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All C4BPB Products

Required fields are marked with *

My Review for All C4BPB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon