Recombinant Human C4BPB
Cat.No. : | C4BPB-26312TH |
Product Overview : | Recombinant full length Human C4 binding protein with N terminal proprietary tag; predicted MWt: 53.35 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants. |
Protein length : | 252 amino acids |
Molecular Weight : | 53.350kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEV EGQILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLG HCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRS QCLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGS TISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPK PECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYS LELKKAELKAKLL |
Sequence Similarities : | Contains 3 Sushi (CCP/SCR) domains. |
Gene Name : | C4BPB complement component 4 binding protein, beta [ Homo sapiens ] |
Official Symbol : | C4BPB |
Synonyms : | C4BPB; complement component 4 binding protein, beta; C4BP, complement component 4 binding protein, beta; C4b-binding protein beta chain; C4b binding protein; beta chain; complement component 4 binding protein; |
Gene ID : | 725 |
mRNA Refseq : | NM_000716 |
Protein Refseq : | NP_000707 |
MIM : | 120831 |
Uniprot ID : | P20851 |
Chromosome Location : | 1q32 |
Pathway : | Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem; |
Products Types
◆ Recombinant Protein | ||
C4BPB-0054H | Recombinant Human C4BPB Protein, GST-Tagged | +Inquiry |
C4BPB-137H | Recombinant Human C4BPB Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
C4BPB-474H | Recombinant Human C4BPB Protein, His (Fc)-Avi-tagged | +Inquiry |
C4BPB-10533H | Recombinant Human C4BPB, His-tagged | +Inquiry |
C4BPB-6970H | Recombinant Human Complement Component 4 Binding Protein, Beta, His-tagged | +Inquiry |
◆ Native Protein | ||
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
◆ Lysates | ||
C4BPB-8036HCL | Recombinant Human C4BPB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket