Recombinant Human CASP3 protein, GST-tagged

Cat.No. : CASP3-334H
Product Overview : Recombinant Human CASP3(1 a.a. - 277 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Tag : GST
Protein Length : 1-277 a.a.
Description : This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 56.21 kDa
AA Sequence : MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLR ETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS LTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQ YADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSILTKELYFYH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CASP3 caspase 3, apoptosis-related cysteine peptidase [ Homo sapiens ]
Official Symbol CASP3
Synonyms CASP3; caspase 3, apoptosis-related cysteine peptidase; caspase 3, apoptosis related cysteine protease; caspase-3; apopain; CPP32; CPP32B; Yama; CASP-3; CPP-32; procaspase3; protein Yama; PARP cleavage protease; cysteine protease CPP32; SREBP cleavage activity 1; caspase 3, apoptosis-related cysteine protease; SCA-1;
Gene ID 836
mRNA Refseq NM_004346
Protein Refseq NP_004337
MIM 600636
UniProt ID P42574
Chromosome Location 4q34
Pathway Activation of DNA fragmentation factor, organism-specific biosystem; Activation of caspases through apoptosome-mediated cleavage, organism-specific biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function aspartic-type endopeptidase activity; cyclin-dependent protein kinase inhibitor activity; cysteine-type endopeptidase activity; cysteine-type endopeptidase activity; peptidase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CASP3 Products

Required fields are marked with *

My Review for All CASP3 Products

Required fields are marked with *

0
cart-icon