Active Recombinant Human CCL1 Protein (74 aa)
Cat.No. : | CCL1-383C |
Product Overview : | Recombinant Human I-309/CCL1 produced in E. coli is a single non-glycosylated polypeptide chain containing 74 amino acids. A fully biologically active molecule, rhI-309/CCL1has a molecular mass of 8.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 74 |
Description : | Chemokine (C-C motif) ligand 1 (CCL1), also known as I-309, is a small glycoprotein secreted by activated T cells that belongs to the family ofchemokines. Human CCL1 has been assumed to be a homologue of mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, immature B cells and dendritic cells by interacting with the cell surface chemokine receptor CCR8. This chemokine resides in a large cluster of CC chemokines on human chromosome 17. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of human I-309/CCL on Ca^2+ mobilization assay in CHO-K1/Gα15/hCCR8 cells (human Gα15 and human CCR8 stably expressed in CHO-K1 cells) is less than 1 μg/mL. |
Molecular Mass : | 8.5 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human I-309/CCL1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant human I-309/CCL1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ] |
Official Symbol | CCL1 |
Synonyms | CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1; |
Gene ID | 6346 |
mRNA Refseq | NM_002981 |
Protein Refseq | NP_002972 |
MIM | 182281 |
UniProt ID | P22362 |
◆ Recombinant Proteins | ||
CCL1-1168H | Recombinant Human CCL1 protein(24-96aa), MBP&His-Avi-tagged, Biotinylated | +Inquiry |
CCL1-30H | Recombinant Human CCL1(Lys24-Lys96) Protein, None-tagged | +Inquiry |
Ccl1-640R | Recombinant Rat Ccl1 Protein, His-tagged | +Inquiry |
CCL1-69H | Recombinant Human CCL1 Protein | +Inquiry |
CCL1-266C | Active Recombinant Human CCL1 Protein (73 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL1-1690MCL | Recombinant Mouse CCL1 cell lysate | +Inquiry |
CCL1-3060HCL | Recombinant Human CCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL1 Products
Required fields are marked with *
My Review for All CCL1 Products
Required fields are marked with *
0
Inquiry Basket