Recombinant Human CCL13 Protein

Cat.No. : CCL13-09H
Product Overview : Recombinant Human CCL13 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Monocyte chemotactic protein 4 (MCP-4), also called CCL13, is induced by inflammatory proteins such as interleukin 1 (IL-1) and tumor necrosis factor alpha (TNF-α). MCP-4 is a ligand for the G protein coupled chemokine receptors CCR2, CCR3, and CCR5. MCP-4 activates signaling in monocytes, T lymphocytes, eosinophils, and basophils during inflammation and allergic responses.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 8.6 kDa (75 aa)
AA Sequence : QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name CCL13 chemokine (C-C motif) ligand 13 [ Homo sapiens (human) ]
Official Symbol CCL13
Synonyms CCL13; chemokine (C-C motif) ligand 13; SCYA13, small inducible cytokine subfamily A (Cys Cys), member 13; C-C motif chemokine 13; CKb10; MCP 4; MGC17134; NCC 1; SCYL1; CK-beta-10; new CC chemokine 1; small-inducible cytokine A13; monocyte chemotactic protein 4; monocyte chemoattractant protein 4; small inducible cytokine subfamily A (Cys-Cys), member 13; NCC1; MCP-4; NCC-1; SCYA13;
Gene ID 6357
mRNA Refseq NM_005408
Protein Refseq NP_005399
MIM 601391
UniProt ID Q99616

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL13 Products

Required fields are marked with *

My Review for All CCL13 Products

Required fields are marked with *

0
cart-icon