Recombinant Human CCL13 Protein
Cat.No. : | CCL13-09H |
Product Overview : | Recombinant Human CCL13 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Monocyte chemotactic protein 4 (MCP-4), also called CCL13, is induced by inflammatory proteins such as interleukin 1 (IL-1) and tumor necrosis factor alpha (TNF-α). MCP-4 is a ligand for the G protein coupled chemokine receptors CCR2, CCR3, and CCR5. MCP-4 activates signaling in monocytes, T lymphocytes, eosinophils, and basophils during inflammation and allergic responses. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 8.6 kDa (75 aa) |
AA Sequence : | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL13 chemokine (C-C motif) ligand 13 [ Homo sapiens (human) ] |
Official Symbol | CCL13 |
Synonyms | CCL13; chemokine (C-C motif) ligand 13; SCYA13, small inducible cytokine subfamily A (Cys Cys), member 13; C-C motif chemokine 13; CKb10; MCP 4; MGC17134; NCC 1; SCYL1; CK-beta-10; new CC chemokine 1; small-inducible cytokine A13; monocyte chemotactic protein 4; monocyte chemoattractant protein 4; small inducible cytokine subfamily A (Cys-Cys), member 13; NCC1; MCP-4; NCC-1; SCYA13; |
Gene ID | 6357 |
mRNA Refseq | NM_005408 |
Protein Refseq | NP_005399 |
MIM | 601391 |
UniProt ID | Q99616 |
◆ Recombinant Proteins | ||
CCL13-078C | Active Recombinant Human CCL13 Protein (75 aa) | +Inquiry |
CCL13-288H | Recombinant Human CCL13 protein | +Inquiry |
CCL13-84H | Recombinant Human CCL13 Protein, Biotin-tagged | +Inquiry |
CCL13-0607H | Recombinant Human CCL13 Protein, GST-Tagged | +Inquiry |
CCL13-1308H | Recombinant Human CCL13 Protein (Gln24-Thr98), N-GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL13-7734HCL | Recombinant Human CCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL13 Products
Required fields are marked with *
My Review for All CCL13 Products
Required fields are marked with *
0
Inquiry Basket