Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
75 |
Description : |
Human CCL13 is belonging to the CC chemokine family and is encoded by the gene CCL13 in humans. CCL13 (MCP-4) shares 56-61 % sequence identity with MCP-1 (CCL2) and MCP-3 (CCL7) and is 60 % identical to Eotaxin (CCL11). CCL13 was a potent chemoattractant for monocytes and eosinophils and stimulated histamine release from basophils. CCL13 can induce a calcium flux in HEK-293 cells transfected with the receptor CCR2B and CCR3. That shows the function receptors of CCL3 are CCR2B and CCR3. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 130 mM NaCl. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human monocytes is in a concentration of 10-100 ng/ml. |
Molecular Mass : |
Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids. |
AA Sequence : |
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
Endotoxin : |
Less than 1 EU/μg of rHuMCP-4/CCL13 as determined by LAL method. |
Purity : |
>96% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |