Recombinant Full Length Human CCL13 Protein, GST-tagged
| Cat.No. : | CCL13-2920HF |
| Product Overview : | Human CCL13 full-length ORF (AAH08621, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 98 amino acids |
| Description : | This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCL13 chemokine (C-C motif) ligand 13 [ Homo sapiens ] |
| Official Symbol | CCL13 |
| Synonyms | CCL13; chemokine (C-C motif) ligand 13; SCYA13, small inducible cytokine subfamily A (Cys Cys), member 13; C-C motif chemokine 13; CKb10; MCP 4; MGC17134; NCC 1; SCYL1; CK-beta-10; new CC chemokine 1; small-inducible cytokine A13; monocyte chemotactic protein 4; monocyte chemoattractant protein 4; small inducible cytokine subfamily A (Cys-Cys), member 13; NCC1; MCP-4; NCC-1; SCYA13; |
| Gene ID | 6357 |
| mRNA Refseq | NM_005408 |
| Protein Refseq | NP_005399 |
| MIM | 601391 |
| UniProt ID | Q99616 |
| ◆ Recombinant Proteins | ||
| CCL13-2729H | Recombinant Human CCL13 Protein, His-tagged | +Inquiry |
| CCL13-1308H | Recombinant Human CCL13 Protein (Gln24-Thr98), N-GST tagged | +Inquiry |
| CCL13-078C | Active Recombinant Human CCL13 Protein (75 aa) | +Inquiry |
| CCL13-221H | Recombinant Human CCL13 Protein, His/GST-tagged | +Inquiry |
| CCL13-73H | Recombinant Human CCL13 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL13-7734HCL | Recombinant Human CCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL13 Products
Required fields are marked with *
My Review for All CCL13 Products
Required fields are marked with *
