Recombinant Human CCL17 Protein
Cat.No. : | CCL17-10H |
Product Overview : | Recombinant Human CCL17 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Thymus and activation regulated chemokine (TARC), also known as CCL17, is a chemokine that is constitutively produced by thymus tissue and activated peripheral blood mononuclear cells (PBMCs), including dendritic cells. TARC signals through the CCR4 receptor to induce chemotaxis of Type 2 T helper (Th2) cells. TARC is important in asthma and allergic diseases, along with bacterial and viral infections. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 8.1 kDa (71 aa) |
AA Sequence : | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens (human) ] |
Official Symbol | CCL17 |
Synonyms | CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; ABCD-2; SCYA17; A-152E5.3; MGC138271; MGC138273; |
Gene ID | 6361 |
mRNA Refseq | NM_002987 |
Protein Refseq | NP_002978 |
MIM | 601520 |
UniProt ID | Q92583 |
◆ Recombinant Proteins | ||
Ccl17-463M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 17 | +Inquiry |
Ccl17-1346R | Recombinant Rat Ccl17 protein | +Inquiry |
CCL17-1471H | Recombinant Human CCL17 Protein (Ala24-Ser94), N-GST tagged | +Inquiry |
CCL17-193H | Recombinant Human CCL17, None tagged | +Inquiry |
Ccl17-622M | Recombinant Mouse Ccl17 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL17 Products
Required fields are marked with *
My Review for All CCL17 Products
Required fields are marked with *