Recombinant Rat Ccl17 protein
Cat.No. : | Ccl17-1346R |
Product Overview : | Recombinant Rat Ccl17 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 70 |
Description : | CCL17 also known as thymus and activation-related chemokine (TARC) is encoded by the CCL17 gene located on the chromosome 16. It is expressed by thymus cells constitutively and phytohemagglutinin-stimulated peripheral blood mononuclear cells transiently. CCL17 signals through the chemokine receptors CCR4 and CCR8 and displays chemotactic activity for T lymphocytes and some other leukocytes. It plays an important role in skin diseases such as atopic dermatitis, bullous pemphigoid and mycosis fungoides. CCL17 has approximately 24 – 29 % amino acid sequence identity with RANTES, MIP-1α, MIP-1β, MCP-1, MCP-2, MCP-3 and I-309. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : | Approximately 8.1 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
AA Sequence : | ARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKDAIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL |
Endotoxin : | Less than 0.1 EU/μg of r rRtTARC/CCL17 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl17 |
Official Symbol | Ccl17 |
Synonyms | CCL17; chemokine (C-C motif) ligand 17; C-C motif chemokine 17; small inducible cytokine subfamily A (Cys-Cys), member 17; Tarc; Scya17; |
Gene ID | 117518 |
mRNA Refseq | NM_057151 |
Protein Refseq | NP_476492 |
UniProt ID | Q9ERE0 |
◆ Recombinant Proteins | ||
CCL17-269H | Recombinant Human Chemokine (C-C motif) ligand 17, His-tagged | +Inquiry |
CCL17-857R | Recombinant Rhesus CCL17 protein | +Inquiry |
CCL17-30149TH | Recombinant Human CCL17, His-tagged | +Inquiry |
CCL17-0265H | Recombinant Human CCL17 protein, His-tagged | +Inquiry |
CCL17-055C | Active Recombinant Human CCL17 Protein (71 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl17 Products
Required fields are marked with *
My Review for All Ccl17 Products
Required fields are marked with *
0
Inquiry Basket