Recombinant Human CCL18 Protein
Cat.No. : | CCL18-11H |
Product Overview : | Recombinant Human CCL18 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Macrophage inflammatory protein-4 (MIP-4), also called CCL18, is a chemokine expressed in the lymph nodes, lungs, placenta, and bone marrow. MIP-4 receptors include the chemokine receptor 8 (CCR8), the G protein-coupled receptor 30 (GPR30), and the phosphatidylinositol transfer protein membrane-associate 3 (PITPNM3). MIP-4 acts as a chemoattractant for naive T cells, CD4+ T cells, CD8+ T cells, and nonactivated lymphocytes. Further, MIP-4 promotes breast cancer metastasis and attenuates the activation of acute lymphocytic leukemia B cells. |
Bio-activity : | No biological activity data is available at this time. |
AA Sequence : | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | CCL18 chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) [ Homo sapiens (human) ] |
Official Symbol | CCL18 |
Synonyms | CCL18; chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); SCYA18, small inducible cytokine subfamily A (Cys Cys), member 18, pulmonary and activation regulated; C-C motif chemokine 18; AMAC 1; CKb7; DC CK1; DCCK1; MIP 4; PARC; CC chemokine PARC; CC chemokine ligand 18; chemokine (C-C), dendritic; dendritic cell chemokine 1; small inducible cytokine A18; small-inducible cytokine A18; macrophage inflammatory protein 4; pulmonary and activation-regulated chemokine; alternative macrophage activation-associated CC chemokine 1; small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary and activation-regulated; AMAC1; MIP-4; AMAC-1; DC-CK1; SCYA18; |
Gene ID | 6362 |
mRNA Refseq | NM_002988 |
Protein Refseq | NP_002979 |
MIM | 603757 |
UniProt ID | P55774 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL18 Products
Required fields are marked with *
My Review for All CCL18 Products
Required fields are marked with *
0
Inquiry Basket