Recombinant Human CCL19 Protein

Cat.No. : CCL19-46H
Product Overview : Recombinant Human CCL19 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 77 amino acid
Description : CCL19 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine. Originally termed MIP-3beta or ELC, CCL19 is expressed in thymus and lymph nodes. The cognate receptor for CCL19 is CCR7 and directs the trafficking of B and T cells.
Form : Lyophilized
Molecular Mass : 8.79626 kDa
AA Sequence : GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPW VERIIQRLQRTSAKMKRRSS
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 19
Gene Name CCL19 C-C motif chemokine ligand 19 [ Homo sapiens (human) ]
Official Symbol CCL19
Synonyms ELC; CKb11; MIP3B; MIP-3b; SCYA19
Gene ID 6363
mRNA Refseq NM_006274
Protein Refseq NP_006265
MIM 602227
UniProt ID Q99731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL19 Products

Required fields are marked with *

My Review for All CCL19 Products

Required fields are marked with *

0
cart-icon