Recombinant Human CCL19 Protein
Cat.No. : | CCL19-46H |
Product Overview : | Recombinant Human CCL19 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 77 amino acid |
Description : | CCL19 protein is expressed in E. coli, processed, refolded and purified to yield the native, secreted form of the mature chemokine. Originally termed MIP-3beta or ELC, CCL19 is expressed in thymus and lymph nodes. The cognate receptor for CCL19 is CCR7 and directs the trafficking of B and T cells. |
Form : | Lyophilized |
Molecular Mass : | 8.79626 kDa |
AA Sequence : | GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPW VERIIQRLQRTSAKMKRRSS |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 19 |
Gene Name | CCL19 C-C motif chemokine ligand 19 [ Homo sapiens (human) ] |
Official Symbol | CCL19 |
Synonyms | ELC; CKb11; MIP3B; MIP-3b; SCYA19 |
Gene ID | 6363 |
mRNA Refseq | NM_006274 |
Protein Refseq | NP_006265 |
MIM | 602227 |
UniProt ID | Q99731 |
◆ Recombinant Proteins | ||
CCL19-163H | Active Recombinant Human Chemokine (C-C motif) Ligand 19, HIgG1 Fc-tagged | +Inquiry |
CCL19-27646TH | Recombinant Human CCL19, T7-tagged | +Inquiry |
CCL19-162H | Active Recombinant Human Chemokine (C-C motif) Ligand 19, HIgG1 Fc-tagged, mutant | +Inquiry |
Ccl19-0620M | Active Recombinant Mouse Ccl19 Protein | +Inquiry |
CCL19-2962M | Recombinant Mouse CCL19 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL19 Products
Required fields are marked with *
My Review for All CCL19 Products
Required fields are marked with *
0
Inquiry Basket