Recombinant Human CCL19 Protein, GST-Tagged

Cat.No. : CCL19-0618H
Product Overview : Human CCL19 full-length ORF (AAH27968, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq, Sep 2014]
Molecular Mass : 36.52 kDa
AA Sequence : MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens ]
Official Symbol CCL19
Synonyms CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433;
Gene ID 6363
mRNA Refseq NM_006274
Protein Refseq NP_006265
MIM 602227
UniProt ID Q99731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL19 Products

Required fields are marked with *

My Review for All CCL19 Products

Required fields are marked with *

0
cart-icon
0
compare icon