Recombinant Human CCL19 Protein, GST-Tagged
| Cat.No. : | CCL19-0618H |
| Product Overview : | Human CCL19 full-length ORF (AAH27968, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq, Sep 2014] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens ] |
| Official Symbol | CCL19 |
| Synonyms | CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433; |
| Gene ID | 6363 |
| mRNA Refseq | NM_006274 |
| Protein Refseq | NP_006265 |
| MIM | 602227 |
| UniProt ID | Q99731 |
| ◆ Recombinant Proteins | ||
| CCL19-46H | Recombinant Human CCL19 Protein | +Inquiry |
| Ccl19-723R | Recombinant Rat Ccl19 protein, His-tagged | +Inquiry |
| Ccl19-2029M | Active Recombinant Mouse Ccl19 Protein | +Inquiry |
| Ccl19-13M | Recombinant Mouse CCL19 Protein | +Inquiry |
| Ccl19-6379R | Recombinant Rat Ccl19 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL19 Products
Required fields are marked with *
My Review for All CCL19 Products
Required fields are marked with *



