Active Recombinant Mouse Ccl19 Protein

Cat.No. : Ccl19-0620M
Product Overview : Mouse Ccl19 (Q548P0) recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Description : Chemokine (C-C motif) ligand 19 (CCL19) is a small cytokine belonging to the CC chemokine family that is also known as EBI1 ligand chemokine (ELC) and macrophage inflammatory protein-3-beta (MIP-3-beta). CCL19 is expressed abundantly in thymus and lymph nodes, with moderate levels in trachea and colon and low levels in stomach, small intestine, lung, kidney and spleen.
Form : Lyophlized
Bio-activity : The activity is determined by the ability to chemoattract primary human T cells and is detectable starting at 20 ng/mL.
Molecular Mass : 7.9 kDa
AA Sequence : GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
Endotoxin : < 0.1 EU/μg
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : No additive
Gene Name Ccl19 chemokine (C-C motif) ligand 19 [ Mus musculus ]
Official Symbol Ccl19
Synonyms CCL19; chemokine (C-C motif) ligand 19; C-C motif chemokine 19; chemokine CCL19; EBI1 ligand chemokine; EBI1-ligand chemokine; EBI-1 ligand chemokine; small inducible cytokine A19; small-inducible cytokine A19; EBV-induced molecule 1 ligand chemokine; epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; CKb11; MIP3B; Scya19; exodus-3;
Gene ID 24047
mRNA Refseq NM_011888
Protein Refseq NP_036018

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl19 Products

Required fields are marked with *

My Review for All Ccl19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon