Active Recombinant Mouse Ccl19 Protein

• Cat.No.: Ccl19-0620M
• Product Overview: Mouse Ccl19 (Q548P0) recombinant protein expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Description: Chemokine (C-C motif) ligand 19 (CCL19) is a small cytokine belonging to the CC chemokine family that is also known as EBI1 ligand chemokine (ELC) and macrophage inflammatory protein-3-beta (MIP-3-beta). CCL19 is expressed abundantly in thymus and lymph nodes, with moderate levels in trachea and colon and low levels in stomach, small intestine, lung, kidney and spleen.
• Form: Lyophlized
• Bio-activity: The activity is determined by the ability to chemoattract primary human T cells and is detectable starting at 20 ng/mL.
• Molecular Mass: 7.9 kDa
• AA Sequence: GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
• Endotoxin: < 0.1 EU/μg
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: No additive

Gene Information

• Gene Name: Ccl19 chemokine (C-C motif) ligand 19 [ Mus musculus ]
• Official Symbol: Ccl19
• Synonyms: CCL19; chemokine (C-C motif) ligand 19; C-C motif chemokine 19; chemokine CCL19; EBI1 ligand chemokine; EBI1-ligand chemokine; EBI-1 ligand chemokine; small inducible cytokine A19; small-inducible cytokine A19; EBV-induced molecule 1 ligand chemokine; epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; CKb11; MIP3B; Scya19; exodus-3
• Gene ID: 24047
• mRNA Refseq: NM_011888
• Protein Refseq: NP_036018