Recombinant Human CCL22

Cat.No. : CCL22-29602TH
Product Overview : Highly pure (>98%) recombinant human MDC.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes.The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology.
Tissue specificity : Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression in small intestine. I
Form : Lyophilised:Reconstitute in water to a concentration of 0.1mg/ml.
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human MDC is an 8.1 kDa protein containing 69 amino acid residues.The 69 amino acid form of MDC contains a Glycine and Proline at the N-terminus:GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF RDKEICADPRVPWVKMILNKLSQ
Sequence Similarities : Belongs to the intercrine beta (chemokine CC) family.
Gene Name CCL22 chemokine (C-C motif) ligand 22 [ Homo sapiens ]
Official Symbol CCL22
Synonyms CCL22; chemokine (C-C motif) ligand 22; SCYA22, small inducible cytokine subfamily A (Cys Cys), member 22; C-C motif chemokine 22; A 152E5.1; ABCD 1; DC/B CK; MDC; MGC34554; STCP 1;
Gene ID 6367
mRNA Refseq NM_002990
Protein Refseq NP_002981
MIM 602957
Uniprot ID O00626
Chromosome Location 16q13
Pathway Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function chemokine activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL22 Products

Required fields are marked with *

My Review for All CCL22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon