Recombinant Human CCL22
Cat.No. : | CCL22-29602TH |
Product Overview : | Highly pure (>98%) recombinant human MDC. |
- Specification
- Gene Information
- Related Products
Description : | This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes.The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. |
Source : | E. coli |
Tissue specificity : | Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression in small intestine. I |
Form : | Lyophilised:Reconstitute in water to a concentration of 0.1mg/ml. |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | Human MDC is an 8.1 kDa protein containing 69 amino acid residues.The 69 amino acid form of MDC contains a Glycine and Proline at the N-terminus:GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF RDKEICADPRVPWVKMILNKLSQ |
Sequence Similarities : | Belongs to the intercrine beta (chemokine CC) family. |
Gene Name : | CCL22 chemokine (C-C motif) ligand 22 [ Homo sapiens ] |
Official Symbol : | CCL22 |
Synonyms : | CCL22; chemokine (C-C motif) ligand 22; SCYA22, small inducible cytokine subfamily A (Cys Cys), member 22; C-C motif chemokine 22; A 152E5.1; ABCD 1; DC/B CK; MDC; MGC34554; STCP 1; |
Gene ID : | 6367 |
mRNA Refseq : | NM_002990 |
Protein Refseq : | NP_002981 |
MIM : | 602957 |
Uniprot ID : | O00626 |
Chromosome Location : | 16q13 |
Pathway : | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; |
Function : | chemokine activity; |
Products Types
◆ Recombinant Protein | ||
Ccl22-042C | Active Recombinant Mouse Ccl22 Protein (68 aa) | +Inquiry |
CCL22-1108P | Recombinant Pig CCL22 Protein, His-tagged | +Inquiry |
CCL22-311H | Recombinant Human CCL22 Protein, His-tagged | +Inquiry |
CCL22-082C | Active Recombinant Human CCL22 Protein (68 aa) | +Inquiry |
CCL22-081C | Active Recombinant Human CCL22 Protein (69 aa) | +Inquiry |
◆ Lysates | ||
CCL22-7728HCL | Recombinant Human CCL22 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket