Recombinant Human CCL3 Protein

• Cat.No.: CCL3-061H
• Product Overview: Recombinant human CCL3 protein

Specification

• Species: Human
• Protein Length: 92
• Description: This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.
• Form: Lyophilized
• AA Sequence: MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: 4°C
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens (human) ]
• Official Symbol: CCL3
• Synonyms: CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha
• Gene ID: 6348
• mRNA Refseq: NM_002983
• Protein Refseq: NP_002974
• MIM: 182283
• UniProt ID: P10147