Active Recombinant Mouse Ccl3 Protein
Cat.No. : | Ccl3-132M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-C motif) ligand 3 (Ccl3) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils. |
Bio-activity : | Determined by its ability to chemoattract murine balb/c splenocytes using a concentration range of 10.0-100.0 ng/ml. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl3 |
Synonyms | Ccl3; chemokine (C-C motif) ligand 3; Mip1a; Scya3; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha; C-C motif chemokine 3; L2G25B; MIP-1-alpha; MIP1 (a); SIS-alpha; TY-5; heparin-binding chemotaxis protein; macrophage inflammatory protein 1-alpha; macrophage inflammatory protein-1alpha; small-inducible cytokine A3 |
Gene ID | 20302 |
mRNA Refseq | NM_011337 |
Protein Refseq | NP_035467 |
UniProt ID | P10855 |
◆ Recombinant Proteins | ||
Ccl3-132M | Active Recombinant Mouse Ccl3 Protein | +Inquiry |
Ccl3-171C | Active Recombinant Mouse Ccl3 Protein (69 aa) | +Inquiry |
CCL3-5633H | Recombinant Human CCL3 protein, His-tagged | +Inquiry |
Ccl3-2037M | Active Recombinant Mouse Ccl3 Protein | +Inquiry |
CCL3-0636H | Active Recombinant Human CCL3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL3-7723HCL | Recombinant Human CCL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl3 Products
Required fields are marked with *
My Review for All Ccl3 Products
Required fields are marked with *