Recombinant Human CCL4 Protein
Cat.No. : | CCL4-71H |
Product Overview : | Recombinant Human CCL4 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 70 amino acid |
Description : | Human CCL4, also designated Macrophage inflammatory protein-1 beta (MIP-1beta), T-cell activation protein 2 (ACT-2) and HC21, is proteolytically processed by CD26 to remove the two N-terminal residues. Full-length and proteolytically processed CCL4 activate the G protein-coupled receptors CCR5. Truncated for CCL4 also activates CCR1 and CCR2b. Human CCL4 is a potent chemoattractant for macrophages, NK cells, and lymphocytes. |
Form : | Lyophilized |
Molecular Mass : | 7.8142 kDa |
AA Sequence : | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQ VCADPSESWVQEYVYDLELN |
Endotoxin : | Endotoxin-free <0.01 EU/ug |
Purity : | Purity assessed by HPLC, Mass Spectrometry, and NMR |
Storage : | Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month. |
tmpcolum67 : | C-C motif chemokine ligand 4 |
Gene Name | CCL4 C-C motif chemokine ligand 4 [ Homo sapiens (human) ] |
Official Symbol | CCL4 |
Synonyms | ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta |
Gene ID | 6351 |
mRNA Refseq | NM_002984 |
Protein Refseq | NP_002975 |
MIM | 182284 |
UniProt ID | M4IQQ5 |
◆ Recombinant Proteins | ||
CCL4-137C | Recombinant Chicken Chemokine (C-C motif) Ligand 4 | +Inquiry |
CCL4-022H | Recombinant Human CCL4 Protein | +Inquiry |
CCL4-872R | Recombinant Rat CCL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL4-151H | Recombinant Human CCL4 Protein, DYKDDDDK-tagged | +Inquiry |
CCL4-074C | Active Recombinant Human CCL4 Protein (69 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL4 Products
Required fields are marked with *
My Review for All CCL4 Products
Required fields are marked with *
0
Inquiry Basket