Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at Attend ADLM 2024 | July 28 - August 1, 2024

Recombinant Human CCL4 Protein

Cat.No. : CCL4-71H
Product Overview : Recombinant Human CCL4 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Human CCL4, also designated Macrophage inflammatory protein-1 beta (MIP-1beta), T-cell activation protein 2 (ACT-2) and HC21, is proteolytically processed by CD26 to remove the two N-terminal residues. Full-length and proteolytically processed CCL4 activate the G protein-coupled receptors CCR5. Truncated for CCL4 also activates CCR1 and CCR2b. Human CCL4 is a potent chemoattractant for macrophages, NK cells, and lymphocytes.
Source : E. coli
Species : Human
Form : Lyophilized
Molecular Mass : 7.8142 kDa
Protein length : 70 amino acid
AA Sequence : APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQ VCADPSESWVQEYVYDLELN
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 4
Gene Name : CCL4 C-C motif chemokine ligand 4 [ Homo sapiens (human) ]
Official Symbol : CCL4
Synonyms : ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta
Gene ID : 6351
mRNA Refseq : NM_002984
Protein Refseq : NP_002975
MIM : 182284
UniProt ID : M4IQQ5

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCL4 Products

Required fields are marked with *

My Review for All CCL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends