Recombinant Human CCL4 Protein

Cat.No. : CCL4-71H
Product Overview : Recombinant Human CCL4 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 70 amino acid
Description : Human CCL4, also designated Macrophage inflammatory protein-1 beta (MIP-1beta), T-cell activation protein 2 (ACT-2) and HC21, is proteolytically processed by CD26 to remove the two N-terminal residues. Full-length and proteolytically processed CCL4 activate the G protein-coupled receptors CCR5. Truncated for CCL4 also activates CCR1 and CCR2b. Human CCL4 is a potent chemoattractant for macrophages, NK cells, and lymphocytes.
Form : Lyophilized
Molecular Mass : 7.8142 kDa
AA Sequence : APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQ VCADPSESWVQEYVYDLELN
Endotoxin : Endotoxin-free <0.01 EU/ug
Purity : Purity assessed by HPLC, Mass Spectrometry, and NMR
Storage : Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
tmpcolum67 : C-C motif chemokine ligand 4
Gene Name CCL4 C-C motif chemokine ligand 4 [ Homo sapiens (human) ]
Official Symbol CCL4
Synonyms ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta
Gene ID 6351
mRNA Refseq NM_002984
Protein Refseq NP_002975
MIM 182284
UniProt ID M4IQQ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL4 Products

Required fields are marked with *

My Review for All CCL4 Products

Required fields are marked with *

0
cart-icon