Recombinant Human CCL4 Protein

• Cat.No.: CCL4-71H
• Product Overview: Recombinant Human CCL4 Protein was expressed in E. coli.

Specification

• Description: Human CCL4, also designated Macrophage inflammatory protein-1 beta (MIP-1beta), T-cell activation protein 2 (ACT-2) and HC21, is proteolytically processed by CD26 to remove the two N-terminal residues. Full-length and proteolytically processed CCL4 activate the G protein-coupled receptors CCR5. Truncated for CCL4 also activates CCR1 and CCR2b. Human CCL4 is a potent chemoattractant for macrophages, NK cells, and lymphocytes.
• Source: E. coli
• Species: Human
• Form: Lyophilized
• Molecular Mass: 7.8142 kDa
• Protein length: 70 amino acid
• AA Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQ VCADPSESWVQEYVYDLELN
• Endotoxin: Endotoxin-free <0.01 EU/ug
• Purity: Purity assessed by HPLC, Mass Spectrometry, and NMR
• Storage: Store at -20 to -80 centigrade for 12 months; Store at 4 centigrade for 6 months; Store at RT for 1 month.
• tmpcolum67: C-C motif chemokine ligand 4

Gene Information

• Gene Name: CCL4 C-C motif chemokine ligand 4 [ Homo sapiens (human) ]
• Official Symbol: CCL4
• Synonyms: ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; AT744.1; MIP-1-beta
• Gene ID: 6351
• mRNA Refseq: NM_002984
• Protein Refseq: NP_002975
• MIM: 182284
• UniProt ID: M4IQQ5