Recombinant Human CCL4 Protein, GST-Tagged
| Cat.No. : | CCL4-0640H |
| Product Overview : | Human CCL4 partial ORF (NP_002975, 24 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012] |
| Molecular Mass : | 33.33 kDa |
| AA Sequence : | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CCL4 chemokine (C-C motif) ligand 4 [ Homo sapiens ] |
| Official Symbol | CCL4 |
| Synonyms | CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026; |
| Gene ID | 6351 |
| mRNA Refseq | NM_002984 |
| Protein Refseq | NP_002975 |
| MIM | 182284 |
| UniProt ID | P13236 |
| ◆ Recombinant Proteins | ||
| Ccl4-634R | Recombinant Rat Ccl4 protein | +Inquiry |
| CCL4-219C | Active Recombinant Human CCL4 Protein (69 aa) | +Inquiry |
| CCL4-79H | Recombinant Human CCL4 Protein, Biotin-tagged | +Inquiry |
| CCL4-2149H | Active Recombinant Human CCL4 protein, His-tagged | +Inquiry |
| CCL4-6531H | Recombinant Human CCL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL4 Products
Required fields are marked with *
My Review for All CCL4 Products
Required fields are marked with *
