Recombinant Human CCL4 Protein, GST-Tagged

Cat.No. : CCL4-0640H
Product Overview : Human CCL4 partial ORF (NP_002975, 24 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012]
Molecular Mass : 33.33 kDa
AA Sequence : APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCL4 chemokine (C-C motif) ligand 4 [ Homo sapiens ]
Official Symbol CCL4
Synonyms CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026;
Gene ID 6351
mRNA Refseq NM_002984
Protein Refseq NP_002975
MIM 182284
UniProt ID P13236

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL4 Products

Required fields are marked with *

My Review for All CCL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon