Active Recombinant Human CCL4 Protein (69 aa)
Cat.No. : | CCL4-074C |
Product Overview : | Recombinant Human CCL4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 69 |
Description : | Both MIP-1 alpha and MIP-1 beta are structurally and functionally related CC chemokines. They participate in the host response to invading bacterial, viral, parasite and fungal pathogens by regulating the trafficking and activation state of selected subgroups of inflammatory cells e.g. macrophages, lymphocytes and NK cells. While both MIP-1 alpha and MIP-1 beta exert similar effects on monocytes their effect on lymphocytes differ; with MIP-1 alpha selectively attracting CD8+ lymphocytes and MIP-1 beta selectively attracting CD4+ lymphocytes. Additionally, MIP-1 alpha and MIP-1 beta have also been shown to be potent chemoattractants for B cells, eosinophils and dendritic cells. Both human and murine MIP-1 alpha and MIP-1 beta are active on human and murine hematopoietic cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by its ability to chemoattract human blood monocytes using a concentration range of 5.0-20.0 ng/mL, corresponding to a Specific Activity of >5 × 10^4 IU/mg. |
Molecular Mass : | 7.6 kDa, a single non-glycosylated polypeptide chain containing 69 amino acids. |
AA Sequence : | APMGSDPPTACCFSYTARKLPHNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
Endotoxin : | Less than 1 EU/mg of rHuMIP-1 beta/CCL4 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM Tris, 500mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CCL4 chemokine (C-C motif) ligand 4 [ Homo sapiens ] |
Official Symbol | CCL4 |
Synonyms | CCL4; chemokine (C-C motif) ligand 4; LAG1, SCYA4, small inducible cytokine A4 (homologous to mouse Mip 1b); C-C motif chemokine 4; Act 2; AT744.1; MIP 1 beta; PAT 744; SIS-gamma; MIP-1-beta(1-69); CC chemokine ligand 4; secreted protein G-26; T-cell activation protein 2; small-inducible cytokine A4; lymphocyte-activation gene 1; G-26 T-lymphocyte-secreted protein; lymphocyte activation gene 1 protein; macrophage inflammatory protein 1-beta; small inducible cytokine A4 (homologous to mouse Mip-1b); ACT2; G-26; HC21; LAG1; LAG-1; MIP1B; SCYA2; SCYA4; MIP1B1; MIP-1-beta; MGC104418; MGC126025; MGC126026; |
Gene ID | 6351 |
mRNA Refseq | NM_002984 |
Protein Refseq | NP_002975 |
MIM | 182284 |
UniProt ID | P13236 |
◆ Recombinant Proteins | ||
CCL4-1282H | Recombinant Human CCL4 Protein (Ala24-Asn92), N-GST tagged | +Inquiry |
CCL4-631C | Active Recombinant Canine CCL4 | +Inquiry |
CCL4-10850H | Recombinant Human CCL4, GST-tagged | +Inquiry |
CCL4-709D | Recombinant Dog CCL4 protein, His & GST-tagged | +Inquiry |
Ccl4-106R | Recombinant Rat Chemokine (C-C Motif) Ligand 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL4-7721HCL | Recombinant Human CCL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL4 Products
Required fields are marked with *
My Review for All CCL4 Products
Required fields are marked with *
0
Inquiry Basket