Recombinant Human CD79B
Cat.No. : | CD79B-27508TH |
Product Overview : | Recombinant full length Human CD79b with N terminal proprietary tag; Predicted MWt 50.60 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein length : | 229 amino acids |
Molecular Weight : | 50.600kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKG SACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQ EMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG IIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE |
Tag : | Non |
Gene Name : | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ] |
Official Symbol : | CD79B |
Synonyms : | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; |
Gene ID : | 974 |
mRNA Refseq : | NM_000626 |
Protein Refseq : | NP_000617 |
MIM : | 147245 |
Uniprot ID : | P40259 |
Chromosome Location : | 17q23 |
Pathway : | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; |
Function : | transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
CD79B-3113H | Recombinant Human CD79B Protein, MYC/DDK-tagged | +Inquiry |
Cd79b-1222M | Recombinant Mouse Cd79b Protein, MYC/DDK-tagged | +Inquiry |
CD79B-574R | Recombinant Rhesus Macaque CD79B Protein, His (Fc)-Avi-tagged | +Inquiry |
CD79B-209H | Recombinant Human CD79B Protein, C-His-tagged | +Inquiry |
Cd79b-8776R | Recombinant Rat Cd79b protein(Met1-Asp158), His-tagged | +Inquiry |
◆ Lysates | ||
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Customer Reviews (3)
Write a reviewRenowned for its reliability and consistency, this protein offers researchers the confidence to achieve accurate and reproducible results in their studies.
The CD79B protein comes highly recommended for its outstanding performance in ELISA assays.
One notable advantage of the CD79B protein is the excellent technical support provided by its manufacturer.
Q&As (5)
Ask a questionCD79B-targeted immunotherapy aims to specifically target B cells, potentially reducing side effects compared to non-specific chemotherapy.
Analyzing CD79B expression helps tailor treatment plans, allowing for more personalized and effective approaches.
Yes, monitoring CD79B levels can aid in detecting minimal residual disease, providing insights into treatment response.
Variability in CD79B expression among different B cell disorders may pose challenges in its use as a standalone diagnostic marker.
Yes, several clinical trials are exploring the efficacy of CD79B-targeted drugs in various B cell disorders.
Ask a Question for All CD79B Products
Required fields are marked with *
My Review for All CD79B Products
Required fields are marked with *
Inquiry Basket