Recombinant Human CD79B
Cat.No. : | CD79B-27508TH |
Product Overview : | Recombinant full length Human CD79b with N terminal proprietary tag; Predicted MWt 50.60 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. |
Protein length : | 229 amino acids |
Molecular Weight : | 50.600kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKG SACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQ EMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG IIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE |
Gene Name : | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ] |
Official Symbol : | CD79B |
Synonyms : | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; |
Gene ID : | 974 |
mRNA Refseq : | NM_000626 |
Protein Refseq : | NP_000617 |
MIM : | 147245 |
Uniprot ID : | P40259 |
Chromosome Location : | 17q23 |
Pathway : | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; |
Function : | transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
CD79B-699H | Recombinant Human CD79B Protein, His-tagged | +Inquiry |
CD79B-209H | Recombinant Human CD79B Protein, C-His-tagged | +Inquiry |
CD79B-171H | Recombinant Human CD79B Protein, Fc-tagged | +Inquiry |
CD79B-0858H | Recombinant Human CD79B Protein, GST-Tagged | +Inquiry |
CD79B-574R | Recombinant Rhesus Macaque CD79B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket