Recombinant Human CD79B
Cat.No. : | CD79B-27508TH |
Product Overview : | Recombinant full length Human CD79b with N terminal proprietary tag; Predicted MWt 50.60 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 229 amino acids |
Description : | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Weight : | 50.600kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKG SACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQ EMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDG IIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLD IDQTATYEDIVTLRTGEVKWSVGEHPGQE |
Gene Name | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ] |
Official Symbol | CD79B |
Synonyms | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta) , IGB; B-cell antigen receptor complex-associated protein beta chain; B29; |
Gene ID | 974 |
mRNA Refseq | NM_000626 |
Protein Refseq | NP_000617 |
MIM | 147245 |
Uniprot ID | P40259 |
Chromosome Location | 17q23 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; |
Function | transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
CD79B-397H | Recombinant Human CD79b molecule, immunoglobulin-associated beta, His-tagged | +Inquiry |
CD79B-143H | Active Recombinant Human CD79B protein, His-tagged | +Inquiry |
Cd79b-6898M | Recombinant Mouse Cd79b(Val26-Asp158) Protein, C-Fc-tagged | +Inquiry |
CD79B-3113H | Recombinant Human CD79B Protein, MYC/DDK-tagged | +Inquiry |
CD79B-89H | Recombinant Human CD79B protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79B Products
Required fields are marked with *
My Review for All CD79B Products
Required fields are marked with *
0
Inquiry Basket