Recombinant Human CD79B Protein, GST-Tagged
Cat.No. : | CD79B-0858H |
Product Overview : | Human CD79B full-length ORF (AAH32651, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.93 kDa |
AA Sequence : | MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CD79B CD79b molecule, immunoglobulin-associated beta [ Homo sapiens ] |
Official Symbol | CD79B |
Synonyms | CD79B; CD79b molecule, immunoglobulin-associated beta; CD79B antigen (immunoglobulin associated beta), IGB; B-cell antigen receptor complex-associated protein beta chain; B29; Ig-beta; B-cell-specific glycoprotein B29; immunoglobulin-associated B29 protein; CD79b antigen (immunoglobulin-associated beta); IGB; AGM6; |
Gene ID | 974 |
mRNA Refseq | NM_000626 |
Protein Refseq | NP_000617 |
MIM | 147245 |
UniProt ID | P40259 |
◆ Recombinant Proteins | ||
CD79B-171H | Recombinant Human CD79B Protein, Fc-tagged | +Inquiry |
Cd79b-6897M | Recombinant Mouse Cd79b protein, His-tagged | +Inquiry |
CD79B-3113H | Recombinant Human CD79B Protein, MYC/DDK-tagged | +Inquiry |
CD79B-27508TH | Recombinant Human CD79B | +Inquiry |
CD79B-749R | Recombinant Rhesus Macaque CD79B(Ala30-Asp161) Protein, C-Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD79B-1827MCL | Recombinant Mouse CD79B cell lysate | +Inquiry |
CD79B-1323RCL | Recombinant Rat CD79B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD79B Products
Required fields are marked with *
My Review for All CD79B Products
Required fields are marked with *