"CD86" Related Products

Expand
Expand

Recombinant Human CD86 Protein, His-Flag-StrepII-Tagged

Cat.No.: CD86-0873H
Product Overview: Purified CD86 (AAH40261.1, 24 a.a. - 246 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Description: This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.[provided by RefSeq, May 2011]
Source: Human cells
Species: Human
Tag : His-Flag-StrepII
Form: Liquid
Bio-activity: Not Tested
Molecular Mass: 29.81 kDa
AA Sequence: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGIMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHI
Applications: Western Blot
Enzyme-linked Immunoabsorbent Assay
SDS-PAGE
Protein Interaction
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration: ≥ 10 μg/mL
Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Gene Name: CD86 CD86 molecule [ Homo sapiens ]
Official Symbol: CD86
Synonyms: CD86; CD86 molecule; CD28LG2, CD86 antigen (CD28 antigen ligand 2, B7 2 antigen); T-lymphocyte activation antigen CD86; B lymphocyte antigen B7 2; B7 2; B7.2; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); B70; B7-2; LAB72; CD28LG2; MGC34413;
Gene ID: 942
mRNA Refseq: NM_001206924
Protein Refseq: NP_001193853
MIM: 601020
UniProt ID: P42081

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.