Recombinant Human CDH5
Cat.No. : | CDH5-31200TH |
Product Overview : | Recombinant fragment (amino acids 51-150) of Human VE Cadherin with proprietary 26 kDa tag; 100 amino acids (Predicted MW 11.45 kDa), 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is a classical cadherin from the cadherin superfamily and is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. The encoded protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classic cadherin by imparting to cells the ability to adhere in a homophilic manner, the protein may play an important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. An alternative splice variant has been described but its full length sequence has not been determined. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Endothelial tissues and brain. |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV |
Sequence Similarities : | Contains 5 cadherin domains. |
Gene Name | CDH5 cadherin 5, type 2 (vascular endothelium) [ Homo sapiens ] |
Official Symbol | CDH5 |
Synonyms | CDH5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE cadherin (vascular epithelium); cadherin-5; 7B4; CD144; VE cadherin; |
Gene ID | 1003 |
mRNA Refseq | NM_001795 |
Protein Refseq | NP_001786 |
MIM | 601120 |
Uniprot ID | P33151 |
Chromosome Location | 16q22.1 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; |
Function | RPTP-like protein binding; beta-catenin binding; calcium ion binding; ion channel binding; protein binding; |
◆ Recombinant Proteins | ||
Cdh5-364M | Recombinant Mouse Cdh5 Protein, His-tagged | +Inquiry |
CDH5-3677H | Recombinant Human CDH5 protein, GST-tagged | +Inquiry |
CDH5-3894H | Recombinant Human CDH5 protein, His-tagged | +Inquiry |
RFL2498MF | Recombinant Full Length Mouse Cadherin-5(Cdh5) Protein, His-Tagged | +Inquiry |
CDH5-5800C | Recombinant Chicken CDH5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH5-2213HCL | Recombinant Human CDH5 cell lysate | +Inquiry |
CDH5-2570MCL | Recombinant Mouse CDH5 cell lysate | +Inquiry |
CDH5-1201RCL | Recombinant Rat CDH5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH5 Products
Required fields are marked with *
My Review for All CDH5 Products
Required fields are marked with *
0
Inquiry Basket