Recombinant Human CDH5 protein, His-tagged
Cat.No. : | CDH5-3894H |
Product Overview : | Recombinant Human CDH5 protein(54-241 aa), fused to His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 54-241 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CDH5 cadherin 5, type 2 (vascular endothelium) [ Homo sapiens ] |
Official Symbol | CDH5 |
Synonyms | CDH5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE cadherin (vascular epithelium); cadherin-5; 7B4; CD144; VE cadherin; 7B4 antigen; VE-cadherin; cd144 antigen; endothelial-specific cadherin; vascular endothelial cadherin; cadherin 5, type 2, VE-cadherin (vascular epithelium); FLJ17376; |
Gene ID | 1003 |
mRNA Refseq | NM_001795 |
Protein Refseq | NP_001786 |
MIM | 601120 |
UniProt ID | P33151 |
◆ Recombinant Proteins | ||
Cdh5-364M | Recombinant Mouse Cdh5 Protein, His-tagged | +Inquiry |
CDH5-128M | Recombinant Mouse CDH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH5-1182Z | Recombinant Zebrafish CDH5 | +Inquiry |
CDH5-501H | Active Recombinant Human CDH5 protein, His-tagged | +Inquiry |
CDH5-2641H | Recombinant Human CDH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH5-2213HCL | Recombinant Human CDH5 cell lysate | +Inquiry |
CDH5-1201RCL | Recombinant Rat CDH5 cell lysate | +Inquiry |
CDH5-2570MCL | Recombinant Mouse CDH5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDH5 Products
Required fields are marked with *
My Review for All CDH5 Products
Required fields are marked with *