| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
121 amino acids |
| Description : |
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. |
| Conjugation : |
HIS |
| Molecular Weight : |
16.900kDa inclusive of tags |
| Tissue specificity : |
Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid. |
| Form : |
Liquid |
| Purity : |
>95% by SDS-PAGE |
| Storage buffer : |
pH: 8.00Constituents:10% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% DTT |
| Storage : |
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : |
MGSSHHHHHHSSGLVPRGSHMGSMWSPKEEDRIIPGGIYN ADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQ TVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQ LCSFEIYEVPWENRRSLVKS RCQES |
| Sequence Similarities : |
Belongs to the cystatin family. |
