Recombinant Human CST1 protein, His-tagged
| Cat.No. : | CST1-11641H |
| Product Overview : | Recombinant Human CST1 protein(24 - 141 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | September 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 24 - 141 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES |
| Gene Name | CST1 cystatin SN [ Homo sapiens ] |
| Official Symbol | CST1 |
| Synonyms | CST1; cystatin SN; cystatin-SN; cystatin 1; cystatin-1; cystain-SA-I; cystatin SA-I; salivary cystatin-SA-1; cysteine proteinase inhibitor, type 2 family; |
| Gene ID | 1469 |
| mRNA Refseq | NM_001898 |
| Protein Refseq | NP_001889 |
| MIM | 123855 |
| UniProt ID | P01037 |
| ◆ Recombinant Proteins | ||
| CST1-1332H | Recombinant Human Cystatin SN, His-tagged | +Inquiry |
| CST1-1842H | Recombinant Human CST1 Protein (Trp21-Ser141), C-His tagged | +Inquiry |
| CST1-2632H | Active Recombinant Human CST1 protein, His-tagged | +Inquiry |
| CST1-3787H | Recombinant Human CST1 protein, rFc-tagged | +Inquiry |
| CST1-191H | Recombinant Human CST1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CST1-1930HCL | Recombinant Human CST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST1 Products
Required fields are marked with *
My Review for All CST1 Products
Required fields are marked with *
