Recombinant Human CST1 protein, His-tagged

Cat.No. : CST1-11641H
Product Overview : Recombinant Human CST1 protein(24 - 141 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability August 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 24 - 141 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Gene Name CST1 cystatin SN [ Homo sapiens ]
Official Symbol CST1
Synonyms CST1; cystatin SN; cystatin-SN; cystatin 1; cystatin-1; cystain-SA-I; cystatin SA-I; salivary cystatin-SA-1; cysteine proteinase inhibitor, type 2 family;
Gene ID 1469
mRNA Refseq NM_001898
Protein Refseq NP_001889
MIM 123855
UniProt ID P01037

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST1 Products

Required fields are marked with *

My Review for All CST1 Products

Required fields are marked with *

0
cart-icon