Recombinant Human CST1 protein, His-tagged
Cat.No. : | CST1-11641H |
Product Overview : | Recombinant Human CST1 protein(24 - 141 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24 - 141 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES |
Gene Name | CST1 cystatin SN [ Homo sapiens ] |
Official Symbol | CST1 |
Synonyms | CST1; cystatin SN; cystatin-SN; cystatin 1; cystatin-1; cystain-SA-I; cystatin SA-I; salivary cystatin-SA-1; cysteine proteinase inhibitor, type 2 family; |
Gene ID | 1469 |
mRNA Refseq | NM_001898 |
Protein Refseq | NP_001889 |
MIM | 123855 |
UniProt ID | P01037 |
◆ Recombinant Proteins | ||
CST1-2023H | Recombinant Human CST1 Protein, GST-tagged | +Inquiry |
CST1-2632H | Active Recombinant Human CST1 protein, His-tagged | +Inquiry |
CST1-2038H | Recombinant Human CST1 protein, His-tagged | +Inquiry |
CST1-191H | Recombinant Human CST1 Protein, His-tagged | +Inquiry |
CST1-1842H | Recombinant Human CST1 Protein (Trp21-Ser141), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST1-1930HCL | Recombinant Human CST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST1 Products
Required fields are marked with *
My Review for All CST1 Products
Required fields are marked with *