Recombinant Human CST1 Protein, GST-tagged
Cat.No. : | CST1-2023H |
Product Overview : | Human CST1 full-length ORF ( NP_001889.2, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 42.8 kDa |
AA Sequence : | MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CST1 cystatin SN [ Homo sapiens ] |
Official Symbol | CST1 |
Synonyms | CST1; cystatin SN; cystatin-SN; cystatin 1; cystatin-1; cystain-SA-I; cystatin SA-I; salivary cystatin-SA-1; cysteine proteinase inhibitor, type 2 family; |
Gene ID | 1469 |
mRNA Refseq | NM_001898 |
Protein Refseq | NP_001889 |
MIM | 123855 |
UniProt ID | P01037 |
◆ Recombinant Proteins | ||
CST1-2632H | Active Recombinant Human CST1 protein, His-tagged | +Inquiry |
CST1-3914H | Recombinant Human CST1 protein, His-tagged | +Inquiry |
CST1-191H | Recombinant Human CST1 Protein, His-tagged | +Inquiry |
CST1-2023H | Recombinant Human CST1 Protein, GST-tagged | +Inquiry |
CST1-1842H | Recombinant Human CST1 Protein (Trp21-Ser141), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST1-1930HCL | Recombinant Human CST1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST1 Products
Required fields are marked with *
My Review for All CST1 Products
Required fields are marked with *
0
Inquiry Basket