Recombinant Human DARC
Cat.No. : | DARC-26807TH |
Product Overview : | Recombinant full length Human DARC with N-Terminal proprietary Tag. Mol Wt 63.07 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 336 amino acids |
Description : | The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 63.070kDa inclusive of tags |
Tissue specificity : | Found in adult kidney, adult spleen, bone marrow and fetal liver. In particular, it is expressed along postcapillary venules throughout the body, except in the adult liver. Erythroid cells and postcapillary venule endothelium are the principle tissues exp |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGD YGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVL SMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGL GSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAG QVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYS TELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQ ALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLP LPEGWFSHLDTLGSKS |
Sequence Similarities : | Belongs to the G-protein coupled receptor Duffy family. |
Gene Name | DARC Duffy blood group, chemokine receptor [ Homo sapiens ] |
Official Symbol | DARC |
Synonyms | DARC; Duffy blood group, chemokine receptor; Duffy blood group , FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD; |
Gene ID | 2532 |
mRNA Refseq | NM_001122951 |
Protein Refseq | NP_001116423 |
MIM | 613665 |
Uniprot ID | Q16570 |
Chromosome Location | 1q21-q22 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Malaria, organism-specific biosystem; Malaria, conserved biosystem; |
Function | C-C chemokine binding; G-protein coupled receptor activity; chemokine receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
DARC-26807TH | Recombinant Human DARC | +Inquiry |
DARC-4582H | Recombinant Human DARC Protein, GST-tagged | +Inquiry |
DARC-26807H | Recombinant Human DARC Protein | +Inquiry |
DARC-6856HF | Recombinant Full Length Human DARC Protein, GST-tagged | +Inquiry |
DARC-115HF | Recombinant Full Length Human DARC Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DARC Products
Required fields are marked with *
My Review for All DARC Products
Required fields are marked with *
0
Inquiry Basket