Recombinant Human DARC Protein

Cat.No. : DARC-26807H
Product Overview : Recombinant human DARC protein without tag was expressed in Wheat Germ(in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Description : The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 35.6 kDa
AA Sequence : MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Applications : AP
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol
Gene Name ACKR1 atypical chemokine receptor 1 (Duffy blood group) [ Homo sapiens (human) ]
Official Symbol DARC
Synonyms ACKR1; atypical chemokine receptor 1 (Duffy blood group); FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1; DARC/ACKR1; atypical chemokine receptor 1; Duffy antigen chemokine receptor; Duffy blood group antigen; Duffy blood group system protein; Duffy blood group, chemokine receptor; Fy glycoprotein; glycoprotein D; plasmodium vivax receptor
Gene ID 2532
mRNA Refseq NM_001122951
Protein Refseq NP_001116423
MIM 613665
UniProt ID Q16570

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DARC Products

Required fields are marked with *

My Review for All DARC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon