Recombinant Full Length Human DARC Protein, GST-tagged

Cat.No. : DARC-5281HF
Product Overview : Human FY full-length ORF ( AAH17817, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 336 amino acids
Description : The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 62.7 kDa
AA Sequence : MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DARC Duffy blood group, chemokine receptor [ Homo sapiens ]
Official Symbol DARC
Synonyms DARC; Duffy blood group, chemokine receptor; Duffy blood group, FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor; FY; GpFy; WBCQ1;
Gene ID 2532
mRNA Refseq NM_001122951
Protein Refseq NP_001116423
MIM 613665
UniProt ID Q16570

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DARC Products

Required fields are marked with *

My Review for All DARC Products

Required fields are marked with *

0
cart-icon