Recombinant Full Length Human DARC Protein, GST-tagged
| Cat.No. : | DARC-5281HF |
| Product Overview : | Human FY full-length ORF ( AAH17817, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 336 amino acids |
| Description : | The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 62.7 kDa |
| AA Sequence : | MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DARC Duffy blood group, chemokine receptor [ Homo sapiens ] |
| Official Symbol | DARC |
| Synonyms | DARC; Duffy blood group, chemokine receptor; Duffy blood group, FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor; FY; GpFy; WBCQ1; |
| Gene ID | 2532 |
| mRNA Refseq | NM_001122951 |
| Protein Refseq | NP_001116423 |
| MIM | 613665 |
| UniProt ID | Q16570 |
| ◆ Recombinant Proteins | ||
| DARC-26807H | Recombinant Human DARC Protein | +Inquiry |
| DARC-4582H | Recombinant Human DARC Protein, GST-tagged | +Inquiry |
| DARC-26807TH | Recombinant Human DARC | +Inquiry |
| DARC-115HF | Recombinant Full Length Human DARC Protein | +Inquiry |
| DARC-1312H | Recombinant Human DARC Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DARC Products
Required fields are marked with *
My Review for All DARC Products
Required fields are marked with *
