Recombinant Full Length Human DARC Protein, GST-tagged
Cat.No. : | DARC-6856HF |
Product Overview : | Recombinant full-length human DARC protein without tag was expressed in Wheat Germ(in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 336 amino acids |
Description : | The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS |
Applications : | AP |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol |
Gene Name | ACKR1 atypical chemokine receptor 1 (Duffy blood group) [ Homo sapiens (human) ] |
Official Symbol | DARC |
Synonyms | ACKR1; atypical chemokine receptor 1 (Duffy blood group); FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1; DARC/ACKR1; atypical chemokine receptor 1; Duffy antigen chemokine receptor; Duffy blood group antigen; Duffy blood group system protein; Duffy blood group, chemokine receptor; Fy glycoprotein; glycoprotein D; plasmodium vivax receptor |
Gene ID | 2532 |
mRNA Refseq | NM_001122951 |
Protein Refseq | NP_001116423 |
MIM | 613665 |
UniProt ID | Q16570 |
◆ Recombinant Proteins | ||
DARC-1312H | Recombinant Human DARC Protein, His-tagged | +Inquiry |
DARC-26807TH | Recombinant Human DARC | +Inquiry |
DARC-115HF | Recombinant Full Length Human DARC Protein | +Inquiry |
DARC-5281HF | Recombinant Full Length Human DARC Protein, GST-tagged | +Inquiry |
DARC-6856HF | Recombinant Full Length Human DARC Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DARC Products
Required fields are marked with *
My Review for All DARC Products
Required fields are marked with *