Recombinant Human DCAF7, His-tagged
Cat.No. : | DCAF7-30698TH |
Product Overview : | Recombinant fragment of Human WDR68 with an N terminal His tag; 298aa, 33.6kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 277 amino acids |
Description : | The WD-repeat protein is encoded by the DCAF7 protein, it is 53% identical to the petunia An11 protein and is conserved in worms and yeast, which do not produce anthocyanins. |
Conjugation : | HIS |
Molecular Weight : | 33.600kDa |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 2.4% Urea |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWD |
Sequence Similarities : | Belongs to the WD repeat DCAF7 family.Contains 4 WD repeats. |
Gene Name | DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens ] |
Official Symbol | DCAF7 |
Synonyms | DCAF7; DDB1 and CUL4 associated factor 7; WD repeat domain 68 , WDR68; DDB1- and CUL4-associated factor 7; HAN11; human anthocyanin; seven WD repeat protein of the AN11 family 1; SWAN 1; |
Gene ID | 10238 |
mRNA Refseq | NM_005828 |
Protein Refseq | NP_005819 |
MIM | 605973 |
Uniprot ID | P61962 |
Chromosome Location | 17q23.3 |
Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
DCAF7-3624H | Recombinant Human DCAF7, His-tagged | +Inquiry |
DCAF7-0583H | Recombinant Human DCAF7 Protein (S2-V342), His/Strep tagged | +Inquiry |
DCAF7-0582H | Recombinant Human DCAF7 Protein (S2-V342), Tag Free | +Inquiry |
DCAF7-4565H | Recombinant Human DCAF7 Protein, GST-tagged | +Inquiry |
DCAF7-3012H | Recombinant Human DDB1 And CUL4 Associated Factor 7, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCAF7-7055HCL | Recombinant Human DCAF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCAF7 Products
Required fields are marked with *
My Review for All DCAF7 Products
Required fields are marked with *
0
Inquiry Basket