Recombinant Human DKK1 Protein, Fc-tagged
Cat.No. : | DKK1-195H |
Product Overview : | Recombinant human DKK1 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 266 |
Description : | This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibits beta-catenin-dependent Wnt signaling. This gene plays a role in embryonic development and may be important in bone formation in adults. Elevated expression of this gene has been observed in numerous human cancers and this protein may promote proliferation, invasion and growth in cancer cell lines. |
Form : | Lyophilized |
Molecular Mass : | 52.4 kDa |
AA Sequence : | MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens (human) ] |
Official Symbol | DKK1 |
Synonyms | DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1; |
Gene ID | 22943 |
mRNA Refseq | NM_012242 |
Protein Refseq | NP_036374 |
MIM | 605189 |
UniProt ID | O94907 |
◆ Recombinant Proteins | ||
DKK1-2060H | Recombinant Human DKK1 Protein (Met1-His266), C-His tagged | +Inquiry |
Dkk1-293D | Active Recombinant Mouse Dkk1 Protein (243 aa) | +Inquiry |
DKK1-194H | Recombinant Human DKK1 Protein, His-tagged | +Inquiry |
DKK1-2491H | Recombinant Human DKK1 protein(32-266 aa), N-His-MBP-His-tagged | +Inquiry |
DKK1-12010H | Recombinant Human DKK1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK1 Products
Required fields are marked with *
My Review for All DKK1 Products
Required fields are marked with *
0
Inquiry Basket