Active Recombinant Human DKK1 Protein
Cat.No. : | DKK1-430D |
Product Overview : | Recombinant Human DKK1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which alsoincludes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbatein vitro. DKK1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK1 not only functions as a head inducer during development, but also regulates joint remodeling and bone formation, which indicate sits role in the pathogenesis of rheumatoid arthritis and multiple myeloma. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 6 μg/mL, measured in stimulation of alkaline phosphatase activity using CCl-226 cells. Up to 180% stimulation of alkaline phosphatase activity was observed at 10.0 μg/mL. |
Molecular Mass : | 17-22 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human DKK1 (rhDKK1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhDKK1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DKK1 |
Synonyms | DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1; |
Gene ID | 22943 |
mRNA Refseq | NM_012242 |
Protein Refseq | NP_036374 |
MIM | 605189 |
UniProt ID | O94907 |
◆ Recombinant Proteins | ||
DKK1-27614TH | Recombinant Human DKK1 | +Inquiry |
DKK1-194H | Recombinant Human DKK1 Protein, His-tagged | +Inquiry |
DKK1-1273R | Recombinant Rhesus monkey DKK1 Protein, His-tagged | +Inquiry |
Dkk1-831R | Recombinant Rat Dkk1 protein, His & GST-tagged | +Inquiry |
DKK1-386H | Active Recombinant Human DKK1, HIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK1-2983HCL | Recombinant Human DKK1 cell lysate | +Inquiry |
DKK1-2622RCL | Recombinant Rhesus DKK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DKK1 Products
Required fields are marked with *
My Review for All DKK1 Products
Required fields are marked with *
0
Inquiry Basket