Active Recombinant Human DKK1 Protein

Cat.No. : DKK1-430D
Product Overview : Recombinant Human DKK1 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Dickkopf related protein 1 (DKK1) is a chemokine that belongs to the DKK protein family, which alsoincludes DKK-2, DKK-3 and DKK-4. DKK-1 was originally identified as a Xenopus head forming molecule that behaves as an antagonist for Wnt signaling. It is one of the most up-regulated genes during androgen-potentiated balding, with DKK-1 messenger RNA up-regulated a few hours after DHT treatment of hair follicles at the dermal papilla in vitro. Neutralizing bodies against DKK-1 reverses DHT effects on outer root sheath keratinocytes. DKK-1 expression is attenuated by L-threonate, a metabolite of ascorbatein vitro. DKK1 promotes LRP6 internalization and degradation as it forms a ternary complex with the cell surface receptor Kremen. DKK1 not only functions as a head inducer during development, but also regulates joint remodeling and bone formation, which indicate sits role in the pathogenesis of rheumatoid arthritis and multiple myeloma.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 6 μg/mL, measured in stimulation of alkaline phosphatase activity using CCl-226 cells. Up to 180% stimulation of alkaline phosphatase activity was observed at 10.0 μg/mL.
Molecular Mass : 17-22 kDa, observed by reducing SDS-PAGE.
AA Sequence : TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant human DKK1 (rhDKK1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhDKK1 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol DKK1
Synonyms DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1;
Gene ID 22943
mRNA Refseq NM_012242
Protein Refseq NP_036374
MIM 605189
UniProt ID O94907

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DKK1 Products

Required fields are marked with *

My Review for All DKK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon