Recombinant Human EBI3 subunit (IL-27/IL-35) Protein

Cat.No. : EBI3-71H
Product Overview : Recombinant Human EBI3 subunit (IL-27/IL-35) Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Epstein-Barr virus induced gene-3 (EBI3) is a secreted glycoprotein belonging to the hematopoietin receptor family related to the p40 subunit of interleukin 12 (IL-12). EBI3 expression is induced in B-lymphocytes in response to Epstein-Barr virus infection. EBI3 forms heterodimers with p28 to form interleukin 27 (IL-27), and with p35 to form interleukin 35 (IL-35). Both IL-27 and IL-35 have anti-inflammatory and regulatory activity.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 23.4 kDa (210 aa)
AA Sequence : MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Endotoxin : ≤5 EUs/μg, Kinetic LAL
Purity : ≥90%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) + 0.5% mannitol
Reconstitution : Sterile 10 mM HCl at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name EBI3 Epstein-Barr virus induced 3 [ Homo sapiens (human) ]
Official Symbol EBI3
Synonyms EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B;
Gene ID 10148
mRNA Refseq NM_005755
Protein Refseq NP_005746
MIM 605816
UniProt ID Q14213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EBI3 Products

Required fields are marked with *

My Review for All EBI3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon