Active Recombinant Human Epstein-Barr Virus Induced 3
Cat.No. : | EBI3-504H |
Product Overview : | Epstein-Barr Virus Induced Gene-3 (EBI-3), is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit ofIL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. Recombinant Human EBI is a non-glycosylated polypeptide chain consisting of 209 amino acids with a molecular weight of 23.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Epstein-Barr virus induced gene 3, also known as EBI3, is a protein which in humans is encoded by the EBI3 gene. This gene was identified by the induction of its expression in B lymphocytes by Epstein-Barr virus infection. The protein encoded by this gene is a secreted glycoprotein, which is a member of the hematopoietin receptor family related to the p40 subunit of interleukin 12 (IL-12). It plays a role in regulating cell-mediated immune responses. |
Form : | Lyopohilized with no additives. |
Purity : | Purity Greater than 90% as determined by: Reducing and non-reducing SDS-PAGE. Analytical HPLC. |
Bio-activity : | Assay data for Human recombinant EBI-3 is based upon qualitative binding to anti-EBI-3 antibody. |
Physical Appearance : | Sterile Filtered white lyophilized (freeze-dried) powder. |
Solubility : | Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of teh vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1-0.5 mg/ml, which can be further diluted into other aqueous solutions. |
Purity Greater than 90% as determined by : | Reducing and non-reducing SDS-PAGE. Analytical HPLC. |
Protein Content determined by : | UV spectroscopy at 280 nm. Quantitation on SDS-PAGE against a known standard. |
Endotoxin Level : | Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug. |
Amino acid sequence : | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
Storage : | Lyophilized product is very stable at -20 degrees. Reconstituted material should be aliquoted and frozen at -20. It is recommended to add a carrier protein (0.1% HSA or BSA) for long term storage. |
Gene Name | EBI3 Epstein-Barr virus induced 3 [ Homo sapiens ] |
Official Symbol | EBI3 |
Synonyms | EBI3; Epstein-Barr virus induced 3; IL27B; cytokine receptor; interleukin-27 subunit beta; Epstein-Barr virus induced gene 3; See EBI3 in MapViewer; IL-27 subunit beta; IL-27B; Epstein-Barr virus-induced gene 3 protein; EBV-induced gene 3 protein |
Gene ID | 10148 |
mRNA Refseq | NM_005755 |
Protein Refseq | NP_005746 |
MIM | 605816 |
UniProt ID | Q14213 |
Chromosome Location | 19p13.3 |
Pathway | IL27-mediated signaling events |
Function | cytokine activity; cytokine receptor activity; interleukin-27 receptor binding; protein binding |
◆ Recombinant Proteins | ||
EBI3-8522H | Recombinant Human EBI3, His tagged | +Inquiry |
Ebi3-239M | Active Recombinant Mouse Ebi3 Protein (Ala23-Pro228), C-His tagged, Animal-free, Carrier-free | +Inquiry |
EBI3-287H | Recombinant Human EBI3, Fc tagged | +Inquiry |
EBI3-59H | Recombinant Active Human EBI3 Protein, His-tagged(C-ter) | +Inquiry |
EBI3-6307Z | Recombinant Zebrafish EBI3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EBI3 Products
Required fields are marked with *
My Review for All EBI3 Products
Required fields are marked with *
0
Inquiry Basket