Recombinant Human EFNA1 Protein, GST-tagged

Cat.No. : EFNA1-3096H
Product Overview : Human EFNA1 full-length ORF ( NP_004419.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008]
Molecular Mass : 50.2 kDa
AA Sequence : MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EFNA1 ephrin-A1 [ Homo sapiens ]
Official Symbol EFNA1
Synonyms EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4; B61; EFL1; EPLG1; LERK-1; TNFAIP4;
Gene ID 1942
mRNA Refseq NM_004428
Protein Refseq NP_004419
MIM 191164
UniProt ID P20827

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA1 Products

Required fields are marked with *

My Review for All EFNA1 Products

Required fields are marked with *

0
cart-icon