Recombinant Full Length Human EFNA1 Protein, GST-tagged
Cat.No. : | EFNA1-4215HF |
Product Overview : | Human EFNA1 full-length ORF ( NP_004419.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 205 amino acids |
Description : | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 50.2 kDa |
AA Sequence : | MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EFNA1 ephrin-A1 [ Homo sapiens ] |
Official Symbol | EFNA1 |
Synonyms | EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4; B61; EFL1; EPLG1; LERK-1; TNFAIP4; |
Gene ID | 1942 |
mRNA Refseq | NM_004428 |
Protein Refseq | NP_004419 |
MIM | 191164 |
UniProt ID | P20827 |
◆ Recombinant Proteins | ||
EFNA1-469R | Recombinant Rat EFNA1 Protein (18-182 aa), GST-tagged | +Inquiry |
Efna1-2753M | Recombinant Mouse Efna1 Protein, Myc/DDK-tagged | +Inquiry |
Efna1-159M | Recombinant Mouse Efna1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFNA1-3264H | Recombinant Human EFNA1 Protein (Asp19-Ser182), C-Fc tagged | +Inquiry |
Efna1-1730M | Recombinant Mouse Ephrin A1, Fc-His | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA1-1514RCL | Recombinant Rat EFNA1 cell lysate | +Inquiry |
EFNA1-2594HCL | Recombinant Human EFNA1 cell lysate | +Inquiry |
EFNA1-2177MCL | Recombinant Mouse EFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA1 Products
Required fields are marked with *
My Review for All EFNA1 Products
Required fields are marked with *