Recombinant Human EFNA1 protein, His-SUMO-tagged
| Cat.No. : | EFNA1-2836H |
| Product Overview : | Recombinant Human EFNA1 protein(P20827)(19-182aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 19-182aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.4 kDa |
| AA Sequence : | DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | EFNA1 ephrin-A1 [ Homo sapiens ] |
| Official Symbol | EFNA1 |
| Synonyms | EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4; B61; EFL1; EPLG1; LERK-1; TNFAIP4; |
| Gene ID | 1942 |
| mRNA Refseq | NM_004428 |
| Protein Refseq | NP_004419 |
| MIM | 191164 |
| UniProt ID | P20827 |
| ◆ Recombinant Proteins | ||
| EFNA1-469R | Recombinant Rat EFNA1 Protein (18-182 aa), GST-tagged | +Inquiry |
| EFNA1-355H | Recombinant Human EFNA1 Protein, Fc-tagged | +Inquiry |
| Efna1-2753M | Recombinant Mouse Efna1 Protein, Myc/DDK-tagged | +Inquiry |
| EFNA1-3265H | Recombinant Human EFNA1 Protein (Asp19-Ser182), C-His tagged | +Inquiry |
| EFNA1-1561H | Recombinant Human EFNA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFNA1-1514RCL | Recombinant Rat EFNA1 cell lysate | +Inquiry |
| EFNA1-150HKCL | Human EFNA1 Knockdown Cell Lysate | +Inquiry |
| EFNA1-2594HCL | Recombinant Human EFNA1 cell lysate | +Inquiry |
| EFNA1-2177MCL | Recombinant Mouse EFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA1 Products
Required fields are marked with *
My Review for All EFNA1 Products
Required fields are marked with *



