Recombinant Human EFNA3
Cat.No. : | EFNA3-28626TH |
Product Overview : | Recombinant full length Human Ephrin A3 with N terminal proprietary tag; Predicted MWt 51.92 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 238 amino acids |
Description : | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. |
Molecular Weight : | 51.920kDa inclusive of tags |
Tissue specificity : | Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSS NQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPG GGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLR MKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEG ENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS |
Sequence Similarities : | Belongs to the ephrin family. |
Gene Name | EFNA3 ephrin-A3 [ Homo sapiens ] |
Official Symbol | EFNA3 |
Synonyms | EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3; |
Gene ID | 1944 |
mRNA Refseq | NM_004952 |
Protein Refseq | NP_004943 |
MIM | 601381 |
Uniprot ID | P52797 |
Chromosome Location | 1q21-q22 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; |
Function | ephrin receptor binding; transmembrane-ephrin receptor activity; |
◆ Recombinant Proteins | ||
EFNA3-1609H | Recombinant Human Ephrin-A3 | +Inquiry |
EFNA3-3099H | Recombinant Human EFNA3 Protein, GST-tagged | +Inquiry |
EFNA3-177H | Active Recombinant Human EFNA3, Fc Chimera | +Inquiry |
EFNA3-579H | Recombinant Human ephrin-A3, His-tagged | +Inquiry |
EFNA3-3316H | Recombinant Human EFNA3 Protein (Gln23-Ser211), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA3-2437HCL | Recombinant Human EFNA3 cell lysate | +Inquiry |
EFNA3-2160MCL | Recombinant Mouse EFNA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA3 Products
Required fields are marked with *
My Review for All EFNA3 Products
Required fields are marked with *
0
Inquiry Basket