Recombinant Human EFNA3 Protein, GST-tagged

Cat.No. : EFNA3-3099H
Product Overview : Human EFNA3 full-length ORF ( AAH17722, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq, Jul 2008]
Molecular Mass : 51.92 kDa
AA Sequence : MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EFNA3 ephrin-A3 [ Homo sapiens ]
Official Symbol EFNA3
Synonyms EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3; EFL-2; LERK-3; EHK1 ligand; ligand of eph-related kinase 3; eph-related receptor tyrosine kinase ligand 3; EFL2; Ehk1-L;
Gene ID 1944
mRNA Refseq NM_004952
Protein Refseq NP_004943
MIM 601381
UniProt ID P52797

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA3 Products

Required fields are marked with *

My Review for All EFNA3 Products

Required fields are marked with *

0
cart-icon